Lineage for d1c2ia_ (1c2i A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. Protein Trypsin(ogen) [50515] (9 species)
  7. Species Cow (Bos taurus) [TaxId:9913] [50516] (497 PDB entries)
    Uniprot P00760
  8. Domain d1c2ia_: 1c2i A: [25908]
    complexed with bak, ca, cl, dms, zn

Details for d1c2ia_

PDB Entry: 1c2i (more details), 1.47 Å

PDB Description: recruiting zinc to mediate potent, specific inhibition of serine proteases
PDB Compounds: (A:) Trypsin

SCOPe Domain Sequences for d1c2ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c2ia_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOPe Domain Coordinates for d1c2ia_ are not available.

Timeline for d1c2ia_: