Lineage for d2mp0b_ (2mp0 B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2082731Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2083013Superfamily b.84.3: Duplicated hybrid motif [51261] (2 families) (S)
    half-barrel sheet of 8 strands sandwiched with two 3-stranded sheets
  5. 2083014Family b.84.3.1: Glucose permease-like [51262] (3 proteins)
  6. 2083021Protein Glucose-specific factor III (glsIII) [51266] (1 species)
    synonym: enzyme IIa-glc
  7. 2083022Species Escherichia coli [TaxId:562] [51267] (11 PDB entries)
  8. 2083032Domain d2mp0b_: 2mp0 B: [259076]
    automated match to d1glaf_
    complexed with po3

Details for d2mp0b_

PDB Entry: 2mp0 (more details)

PDB Description: protein phosphorylation upon a fleeting encounter
PDB Compounds: (B:) Glucose-specific phosphotransferase enzyme IIA component

SCOPe Domain Sequences for d2mp0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mp0b_ b.84.3.1 (B:) Glucose-specific factor III (glsIII) {Escherichia coli [TaxId: 562]}
tieiiaplsgeivniedvpdvvfaekivgdgiaikptgnkmvapvdgtigkifetnhafs
iesdsgvelfvhfgidtvelkgegfkriaeegqrvkvgdtviefdlplleekakstltpv
visnmdeikeliklsgsvtvgetpvirik

SCOPe Domain Coordinates for d2mp0b_:

Click to download the PDB-style file with coordinates for d2mp0b_.
(The format of our PDB-style files is described here.)

Timeline for d2mp0b_: