Lineage for d3wtyc_ (3wty C:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1478534Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1478982Family a.4.5.21: ets domain [46859] (9 proteins)
  6. 1479027Protein automated matches [191121] (2 species)
    not a true protein
  7. 1479028Species Human (Homo sapiens) [TaxId:9606] [193283] (8 PDB entries)
  8. 1479039Domain d3wtyc_: 3wty C: [259052]
    Other proteins in same PDB: d3wtya_
    automated match to d1gvjb_
    protein/DNA complex

Details for d3wtyc_

PDB Entry: 3wty (more details), 2.7 Å

PDB Description: crystal structure of the complex comprised of ets1(g333p), runx1, cbfbeta, and the tcralpha gene enhancer dna
PDB Compounds: (C:) Protein C-ets-1

SCOPe Domain Sequences for d3wtyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wtyc_ a.4.5.21 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvipaaalagytgsppiqlwqfllelltdkscqsfiswtgdgwefklsdpdevarrwgkr
knkpkmnyeklsrglryyydkniihktagkryvyrfvcdlqsllgytpeelhamldvk

SCOPe Domain Coordinates for d3wtyc_:

Click to download the PDB-style file with coordinates for d3wtyc_.
(The format of our PDB-style files is described here.)

Timeline for d3wtyc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3wtya_