SCOPe 2.08: Domain d4ot1l2: 4ot1 L:111-214

Lineage for d4ot1l2 (4ot1 L:111-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4ot1l2: 4ot1 L:111-214 [258970]
   Other proteins in same PDB: d4ot1h_, d4ot1l1
   automated match to d2fb4l2
   complexed with edo, epe

Details for d4ot1l2

PDB Entry: 4ot1, 2.11 Å

PDB Description: structural basis for the recognition of human cytomegalovirus glycoprotein b by the neutralizing human antibody sm5-1

PDB Compounds: (L:) SM5-1 Fab Light Chain

SCOPe Domain Sequences for d4ot1l2:

Sequence; same for both SEQRES and ATOM records:

>d4ot1l2 b.1.1.2 (L:111-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptec

Timeline for d4ot1l2:

• d4ot1l2 first appeared in SCOPe 2.04
  
• d4ot1l2 appears in SCOPe 2.07