Lineage for d4trrd_ (4trr D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2107207Species Burkholderia cenocepacia [TaxId:216591] [193149] (10 PDB entries)
  8. 2107246Domain d4trrd_: 4trr D: [258823]
    automated match to d1zjya1
    complexed with edo, so4

Details for d4trrd_

PDB Entry: 4trr (more details), 1.9 Å

PDB Description: crystal structure of a putative putative d-beta-hydroxybutyrate dehydrogenase from burkholderia cenocepacia j2315
PDB Compounds: (D:) Putative D-beta-hydroxybutyrate dehydrogenase

SCOPe Domain Sequences for d4trrd_:

Sequence, based on SEQRES records: (download)

>d4trrd_ c.2.1.0 (D:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
nlngktavvtgaasgigkeialelakagaavaiadlnqdganavadeinkaggkaigvam
dvtneeavntgidkvaeafgsvdilvsnagiqivnpienysfadwkkmqaihvdgafltt
kaalkhmykddrggvviymgsvhsheasplksayvtakhgllglarvlakegakhnvrsh
vvcpgfvrtplvdkqipeqakelgiseeevikkvmlgntvdgvfttvqdvaqtvlflsaf
psaaltgqsfivshgwfmq

Sequence, based on observed residues (ATOM records): (download)

>d4trrd_ c.2.1.0 (D:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
nlngktavvtgaasgigkeialelakagaavaiadlnqdganavadeinkaggkaigvam
dvtneeavntgidkvaeafgsvdilvsnagiqivnpienysfadwkkmqaihvdgafltt
kaalkhmykddrggvviymgsvhsheasplksayvtakhgllglarvlakegakhnvrsh
vvcpgfvrtplvdkqipeqakeseeevikkvmlgntvdgvfttvqdvaqtvlflsafpsa
altgqsfivshgwfmq

SCOPe Domain Coordinates for d4trrd_:

Click to download the PDB-style file with coordinates for d4trrd_.
(The format of our PDB-style files is described here.)

Timeline for d4trrd_: