Lineage for d4qt4b_ (4qt4 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2495627Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2497093Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) (S)
  5. 2497110Family c.56.3.0: automated matches [193325] (1 protein)
    not a true family
  6. 2497111Protein automated matches [193326] (11 species)
    not a true protein
  7. 2497182Species Streptococcus pyogenes [TaxId:471876] [257616] (2 PDB entries)
  8. 2497184Domain d4qt4b_: 4qt4 B: [258811]
    automated match to d4jx9a_

Details for d4qt4b_

PDB Entry: 4qt4 (more details), 2.19 Å

PDB Description: Crystal structure of Peptidyl-tRNA hydrolase from a Gram-positive bacterium, Streptococcus pyogenes at 2.19 Angstrom resolution shows the Closed Structure of the Substrate Binding Cleft
PDB Compounds: (B:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d4qt4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qt4b_ c.56.3.0 (B:) automated matches {Streptococcus pyogenes [TaxId: 471876]}
mvkmivglgnpgskyektkhnigfmaidnivknldvtftddknfkaqigstfinhekvyf
vkpttfmnnsgiavkalltyyniditdliviyddldmevsklrlrskgsagghngiksii
ahigtqefnrikvgigrplkgmtvinhvmgqfntedniaisltldrvvnavkfylqendf
ektmqkfng

SCOPe Domain Coordinates for d4qt4b_:

Click to download the PDB-style file with coordinates for d4qt4b_.
(The format of our PDB-style files is described here.)

Timeline for d4qt4b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4qt4a_