Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (17 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries) |
Domain d4pjif2: 4pji F:116-242 [258749] Other proteins in same PDB: d4pjia1, d4pjia2, d4pjib1, d4pjib2, d4pjic1, d4pjic2, d4pjid1, d4pjid2, d4pjie1, d4pjif1, d4pjig1, d4pjih1 automated match to d3of6b2 complexed with 30w, gol, na |
PDB Entry: 4pji (more details), 2.5 Å
SCOPe Domain Sequences for d4pjif2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pjif2 b.1.1.2 (F:116-242) automated matches {Human (Homo sapiens) [TaxId: 9606]} lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs aeawgra
Timeline for d4pjif2: