SCOPe 2.04: Domain d4m3ka_: 4m3k A:

Lineage for d4m3ka_ (4m3k A:)

1. Root: SCOPe 2.04

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein automated matches [190161] (19 species)
   not a true protein

7. Species Bacillus licheniformis [TaxId:1402] [188244] (9 PDB entries)

8. Domain d4m3ka_: 4m3k A: [258681]
   automated match to d2blma_
   complexed with cl

Details for d4m3ka_

PDB Entry: 4m3k, 1.48 Å

PDB Description: Structure of a single domain camelid antibody fragment cAb-H7S in complex with the BlaP beta-lactamase from Bacillus licheniformis

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d4m3ka_:

Sequence; same for both SEQRES and ATOM records:

>d4m3ka_ e.3.1.1 (A:) automated matches {Bacillus licheniformis [TaxId: 1402]}
mkddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksiedl
nqritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslkke
lrkigdevtnperfepelnevnpgetqdtstaralvtslrafaledpgklpsekrellid
wmkrnttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssrdkkd
akyddkliaeatkvvmkaln

Timeline for d4m3ka_:

• d4m3ka_ is new in SCOPe 2.04-stable
  
• d4m3ka_ appears in SCOPe 2.05
  
• d4m3ka_ appears in the current release, SCOPe 2.08