SCOPe 2.05: Domain d4qd2j1: 4qd2 J:2-101

Lineage for d4qd2j1 (4qd2 J:2-101)

Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.6: Cadherin-like [49313] (3 families)
Family b.1.6.1: Cadherin [49314] (3 proteins)
Protein E-cadherin (epithelial) [49317] (2 species)
synonym: uvomorulin
Species Mouse (Mus musculus) [TaxId:10090] [49318] (14 PDB entries)
Domain d4qd2j1: 4qd2 J:2-101 [258347]
Other proteins in same PDB: d4qd2c1, d4qd2d1, d4qd2d2, d4qd2h1, d4qd2h2, d4qd2i1, d4qd2i2
automated match to d1ff5a1
complexed with ca

Details for d4qd2j1

PDB Entry: 4qd2 (more details), 2.4 Å

PDB Description: Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex

PDB Compounds: (J:) Cadherin-1

SCOPe Domain Sequences for d4qd2j1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qd2j1 b.1.6.1 (J:2-101) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]}
wvippiscpenekgefpknlvqiksnrdketkvfysitgqgadkppvgvfiieretgwlk
vtqpldreaiakyilyshavssngeavedpmeivitvtdq

SCOPe Domain Coordinates for d4qd2j1:

Click to download the PDB-style file with coordinates for d4qd2j1.
(The format of our PDB-style files is described here.)

Timeline for d4qd2j1: