Lineage for d4qd2j2 (4qd2 J:102-213)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1768942Superfamily b.1.6: Cadherin-like [49313] (3 families) (S)
  5. 1768943Family b.1.6.1: Cadherin [49314] (3 proteins)
  6. 1768951Protein E-cadherin (epithelial) [49317] (2 species)
    synonym: uvomorulin
  7. 1768966Species Mouse (Mus musculus) [TaxId:10090] [49318] (14 PDB entries)
  8. 1769001Domain d4qd2j2: 4qd2 J:102-213 [258348]
    Other proteins in same PDB: d4qd2c1, d4qd2d1, d4qd2d2, d4qd2h1, d4qd2h2, d4qd2i1, d4qd2i2
    automated match to d1ff5a2
    complexed with ca

Details for d4qd2j2

PDB Entry: 4qd2 (more details), 2.4 Å

PDB Description: Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex
PDB Compounds: (J:) Cadherin-1

SCOPe Domain Sequences for d4qd2j2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qd2j2 b.1.6.1 (J:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]}
ndnrpeftqevfegsvaegavpgtsvmkvsatdadddvntynaaiaytivsqdpelphkn
mftvnrdtgvisvltsgldresyptytlvvqaadlqgeglsttakavitvkd

SCOPe Domain Coordinates for d4qd2j2:

Click to download the PDB-style file with coordinates for d4qd2j2.
(The format of our PDB-style files is described here.)

Timeline for d4qd2j2: