SCOPe 2.04: Domain d4qd2h2: 4qd2 H:152-294

Lineage for d4qd2h2 (4qd2 H:152-294)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.0: automated matches [227190] (1 protein)
   not a true family

6. Protein automated matches [226913] (8 species)
   not a true protein

7. Species Clostridium botulinum [TaxId:1491] [254975] (6 PDB entries)

8. Domain d4qd2h2: 4qd2 H:152-294 [258346]
   Other proteins in same PDB: d4qd2j1, d4qd2j2
   automated match to d4lo0a2
   complexed with ca

Details for d4qd2h2

PDB Entry: 4qd2, 2.4 Å

PDB Description: Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex

PDB Compounds: (H:) Hemagglutinin component HA33

SCOPe Domain Sequences for d4qd2h2:

Sequence; same for both SEQRES and ATOM records:

>d4qd2h2 b.42.2.0 (H:152-294) automated matches {Clostridium botulinum [TaxId: 1491]}
nftckispildlnkvvqqvdvtnlnvnlytwdygrnqkwtiryneekaayqffntilsng
vltwifsngntvrvsssndqnndaqywlinpvsdtdetytitnlrdttkaldlyggqtan
gtaiqvfnyhgddnqkwnirnpp

Timeline for d4qd2h2:

• d4qd2h2 is new in SCOPe 2.04-stable
  
• d4qd2h2 appears in SCOPe 2.05
  
• d4qd2h2 appears in the current release, SCOPe 2.08