Lineage for d4qd2h2 (4qd2 H:152-294)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543030Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1543418Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 1543626Family b.42.2.0: automated matches [227190] (1 protein)
    not a true family
  6. 1543627Protein automated matches [226913] (8 species)
    not a true protein
  7. 1543631Species Clostridium botulinum [TaxId:1491] [254975] (6 PDB entries)
  8. 1543654Domain d4qd2h2: 4qd2 H:152-294 [258346]
    Other proteins in same PDB: d4qd2j1, d4qd2j2
    automated match to d4lo0a2
    complexed with ca

Details for d4qd2h2

PDB Entry: 4qd2 (more details), 2.4 Å

PDB Description: Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex
PDB Compounds: (H:) Hemagglutinin component HA33

SCOPe Domain Sequences for d4qd2h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qd2h2 b.42.2.0 (H:152-294) automated matches {Clostridium botulinum [TaxId: 1491]}
nftckispildlnkvvqqvdvtnlnvnlytwdygrnqkwtiryneekaayqffntilsng
vltwifsngntvrvsssndqnndaqywlinpvsdtdetytitnlrdttkaldlyggqtan
gtaiqvfnyhgddnqkwnirnpp

SCOPe Domain Coordinates for d4qd2h2:

Click to download the PDB-style file with coordinates for d4qd2h2.
(The format of our PDB-style files is described here.)

Timeline for d4qd2h2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4qd2h1