Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins) |
Protein Epidermolytic (exfoliative) toxin A [50510] (1 species) probable glutamic acid-specific protease |
Species Staphylococcus aureus [TaxId:1280] [50511] (4 PDB entries) |
Domain d1agja_: 1agj A: [25827] CASP2 |
PDB Entry: 1agj (more details), 1.7 Å
SCOPe Domain Sequences for d1agja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} evsaeeikkheekwnkyygvnafnlpkelfskvdekdrqkypyntignvfvkgqtsatgv ligkntvltnrhiakfangdpskvsfrpsintddngntetpygeyevkeilqepfgagvd lalirlkpdqngvslgdkispakigtsndlkdgdkleligypfdhkvnqmhrseielttl srglryygftvpgnsgsgifnsngelvgihsskvshldrehqinygvgignyvkriinek ne
Timeline for d1agja_: