SCOPe 2.05: Domain d4pzna_: 4pzn A:

Lineage for d4pzna_ (4pzn A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins)

6. Protein automated matches [190030] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187366] (4 PDB entries)

8. Domain d4pzna_: 4pzn A: [258252]
   automated match to d1kw4a_
   complexed with edo

Details for d4pzna_

PDB Entry: 4pzn, 2.3 Å

PDB Description: Crystal structure of PHC3 SAM L971E

PDB Compounds: (A:) Polyhomeotic-like protein 3

SCOPe Domain Sequences for d4pzna_:

Sequence; same for both SEQRES and ATOM records:

>d4pzna_ a.60.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepsiwtvddvwafihslpgcqdiadefraqeidgqallllkedhlmsamniklgpaeki
carinslkes

Timeline for d4pzna_:

• d4pzna_ first appeared in SCOPe 2.04
  
• d4pzna_ appears in SCOPe 2.06
  
• d4pzna_ appears in the current release, SCOPe 2.08