SCOP 1.59: Domain d2sgpe_: 2sgp E:

Lineage for d2sgpe_ (2sgp E:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.1: Prokaryotic proteases [50495] (9 proteins)

6. Protein Protease B [50508] (1 species)

7. Species Streptomyces griseus, strain k1 [TaxId:1911] [50509] (11 PDB entries)

8. Domain d2sgpe_: 2sgp E: [25825]
   Other proteins in same PDB: d2sgpi_

Details for d2sgpe_

PDB Entry: 2sgp, 1.8 Å

PDB Description: pro 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 6.5

SCOP Domain Sequences for d2sgpe_:

Sequence; same for both SEQRES and ATOM records:

>d2sgpe_ b.47.1.1 (E:) Protease B {Streptomyces griseus, strain k1}
isggdaiysstgrcslgfnvrsgstyyfltaghctdgattwwansarttvlgttsgssfp
nndygivrytnttipkdgtvggqditsaanatvgmavtrrgsttgthsgsvtalnatvny
gggdvvygmirtnvcaepgdsggplysgtraigltsggsgncssggttffqpvtealsay
gvsvy

Timeline for d2sgpe_:

• d2sgpe_ first appeared (with stable ids) in SCOP 1.55
  
• d2sgpe_ appears in SCOP 1.57
  
• d2sgpe_ appears in SCOP 1.61
  
• d2sgpe_ appears in the current release, SCOPe 2.08