SCOPe 2.04: Domain d4p5oa2: 4p5o A:687-776

Lineage for d4p5oa2 (4p5o A:687-776)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.34: SCF ubiquitin ligase complex WHB domain [74679] (3 proteins)

6. Protein Anaphase promoting complex (APC) [74680] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74682] (4 PDB entries)
   Uniprot Q13616 17-776

8. Domain d4p5oa2: 4p5o A:687-776 [258093]
   Other proteins in same PDB: d4p5oa1, d4p5ob_, d4p5oh_, d4p5oi_
   automated match to d1ldja1
   complexed with zn

Details for d4p5oa2

PDB Entry: 4p5o, 3.11 Å

PDB Description: structure of an rbx1-ubc12~nedd8-cul1-dcn1 complex: a ring-e3- e2~ubiquitin-like protein-substrate intermediate trapped in action

PDB Compounds: (A:) Cullin-1

SCOPe Domain Sequences for d4p5oa2:

Sequence; same for both SEQRES and ATOM records:

>d4p5oa2 a.4.5.34 (A:687-776) Anaphase promoting complex (APC) {Human (Homo sapiens) [TaxId: 9606]}
pmkteqkqeqetthknieedrklliqaaivrimrmrkvlkhqqllgevltqlssrfkprv
pvikkcidiliekeylervdgekdtysyla

Timeline for d4p5oa2:

• d4p5oa2 is new in SCOPe 2.04-stable
  
• d4p5oa2 appears in SCOPe 2.05
  
• d4p5oa2 appears in the current release, SCOPe 2.08