SCOPe 2.07: Domain d4p08a2: 4p08 A:352-574

Lineage for d4p08a2 (4p08 A:352-574)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.0: automated matches [191481] (1 protein)
   not a true family

6. Protein automated matches [190770] (49 species)
   not a true protein

7. Species Rhodococcus sp. [TaxId:104109] [232531] (9 PDB entries)

8. Domain d4p08a2: 4p08 A:352-574 [258062]
   Other proteins in same PDB: d4p08a1
   automated match to d3i2ha2

Details for d4p08a2

PDB Entry: 4p08, 2.34 Å

PDB Description: engineered thermostable dimeric cocaine esterase

PDB Compounds: (A:) cocaine esterase

SCOPe Domain Sequences for d4p08a2:

Sequence; same for both SEQRES and ATOM records:

>d4p08a2 b.18.1.0 (A:352-574) automated matches {Rhodococcus sp. [TaxId: 104109]}
plpdtaytpfylggsgaantstgggtlstsisgtesadtylydpadpvpslggtllfhng
dngpadqrpihdrddvlcystevltdpvevtgtvsarlfvsssavdtdftaklvdvfpdg
raialcdgivrmryretlvnptlieageiyevaidmlatsnvflpghrimvqvsssnfpk
ydrnsntggviareqleemctavnrihrgpehpshivlpiikr

Timeline for d4p08a2:

• d4p08a2 first appeared in SCOPe 2.04
  
• d4p08a2 appears in SCOPe 2.06
  
• d4p08a2 appears in the current release, SCOPe 2.08