Lineage for d5lpra_ (5lpr A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794586Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)
  6. 2794592Protein alpha-Lytic protease [50498] (1 species)
  7. 2794593Species Lysobacter enzymogenes, 495 [TaxId:69] [50499] (46 PDB entries)
  8. 2794623Domain d5lpra_: 5lpr A: [25789]
    complexed with so4; mutant

Details for d5lpra_

PDB Entry: 5lpr (more details), 2.13 Å

PDB Description: structural basis for broad specificity in alpha-lytic protease mutants
PDB Compounds: (A:) alpha-lytic protease

SCOPe Domain Sequences for d5lpra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lpra_ b.47.1.1 (A:) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]}
anivggieysinnaslcsvgfsvtrgatkgfvtaghcgtvnatariggavvgtfaarvfp
gndrawvsltsaqtllprvangssfvtvrgsteaavgaavcrsgrttgyqcgtitaknvt
anyaegavrgltqgnacmgrgdsggswitsagqaqgvasggnvqsngnncgipasqrssl
ferlqpilsqyglslvtg

SCOPe Domain Coordinates for d5lpra_:

Click to download the PDB-style file with coordinates for d5lpra_.
(The format of our PDB-style files is described here.)

Timeline for d5lpra_: