Lineage for d4cbsa_ (4cbs A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2895682Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)
  6. 2895951Protein automated matches [190399] (10 species)
    not a true protein
  7. 2895970Species Human (Homo sapiens) [TaxId:9606] [189951] (11 PDB entries)
  8. 2895982Domain d4cbsa_: 4cbs A: [257742]
    automated match to d3kgwb_
    complexed with plp; mutant

Details for d4cbsa_

PDB Entry: 4cbs (more details), 2.3 Å

PDB Description: x-ray structure of quintuple mutant of human alanine glyoxylate aminotransferase, agxt_rheam
PDB Compounds: (A:) Serine--pyruvate aminotransferase

SCOPe Domain Sequences for d4cbsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cbsa_ c.67.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hkllvtppkallkplsipnrlllgpgpsnlpprimaagglqmighmskemyqimdeikeg
iqyvfqtrnpltlvisgsghcaleaalvnvlepgdsflvgangiwgqraadigerigarv
hpmtkdpgghytlqeveeglaqhkpvllflthgesstgvlqpldgfgelchrykclllvd
svaslggtplymdrqgidilysgsqkalnappgtslisfsdkakkkmysrktkpfsfyld
ikwlanfwgcddqprmyhhtipvislyslreslaliaeqglenswrqhreaaaylhgrlq
alglqlfvkdpalrlptvttvavpagydwrdivsyvmdhfdieimgglgpstgkvlrigl
lgcnatrenvdrvtealraalqhcp

SCOPe Domain Coordinates for d4cbsa_:

Click to download the PDB-style file with coordinates for d4cbsa_.
(The format of our PDB-style files is described here.)

Timeline for d4cbsa_: