![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
![]() | Protein Pseudoazurin [49522] (4 species) |
![]() | Species Thiosphaera pantotropha [TaxId:82367] [49526] (5 PDB entries) |
![]() | Domain d4bxva_: 4bxv A: [257723] automated match to d3erxa_ complexed with cu, so4; mutant |
PDB Entry: 4bxv (more details), 1.76 Å
SCOPe Domain Sequences for d4bxva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bxva_ b.6.1.1 (A:) Pseudoazurin {Thiosphaera pantotropha [TaxId: 82367]} athevhmlnkgesgamvfepafvraepgdvinfvptdkshnveaikeilpegvesfkski nesytltvtepglygvkctphfgmgmvglvqvgdapenldaaktakmpakarermdaela qvn
Timeline for d4bxva_: