SCOPe 2.08: Domain d1d2ec2: 1d2e C:349-451

Lineage for d1d2ec2 (1d2e C:349-451)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families)
   probably related to the second domain and its superfamiy by a circular permutation

5. Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (7 proteins)

6. Protein Elongation factor Tu (EF-Tu) [50467] (4 species)

7. Species Cow (Bos taurus), mitochondrial [TaxId:9913] [50471] (2 PDB entries)
   Uniprot P49410 56-452

8. Domain d1d2ec2: 1d2e C:349-451 [25743]
   Other proteins in same PDB: d1d2ea1, d1d2ea3, d1d2eb1, d1d2eb3, d1d2ec1, d1d2ec3, d1d2ed1, d1d2ed3
   protein/RNA complex; complexed with gdp, mg

Details for d1d2ec2

PDB Entry: 1d2e, 1.94 Å

PDB Description: crystal structure of mitochondrial ef-tu in complex with gdp

PDB Compounds: (C:) elongation factor tu (ef-tu)

SCOPe Domain Sequences for d1d2ec2:

Sequence; same for both SEQRES and ATOM records:

>d1d2ec2 b.44.1.1 (C:349-451) Elongation factor Tu (EF-Tu) {Cow (Bos taurus), mitochondrial [TaxId: 9913]}
hqkveaqvyiltkeeggrhkpfvshfmpvmfsltwdmacriilppgkelampgedlkltl
ilrqpmilekgqrftlrdgnrtigtglvtdtpamteedknikw

Timeline for d1d2ec2:

• d1d2ec2 first appeared (with stable ids) in SCOP 1.55
  
• d1d2ec2 appears in SCOPe 2.07