Lineage for d1d2ed3 (1d2e D:55-250)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867148Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)
  7. 2867149Species Cow (Bos taurus), mitochondrial [TaxId:9913] [52630] (2 PDB entries)
    Uniprot P49410 56-452
  8. 2867154Domain d1d2ed3: 1d2e D:55-250 [32139]
    Other proteins in same PDB: d1d2ea1, d1d2ea2, d1d2eb1, d1d2eb2, d1d2ec1, d1d2ec2, d1d2ed1, d1d2ed2
    protein/RNA complex; complexed with gdp, mg

Details for d1d2ed3

PDB Entry: 1d2e (more details), 1.94 Å

PDB Description: crystal structure of mitochondrial ef-tu in complex with gdp
PDB Compounds: (D:) elongation factor tu (ef-tu)

SCOPe Domain Sequences for d1d2ed3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d2ed3 c.37.1.8 (D:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]}
kphvnvgtighvdhgkttltaaitkilaegggakfkkyeeidnapeerargitinaahve
ystaarhyahtdcpghadyvknmitgtapldgcilvvaandgpmpqtrehlllarqigve
hvvvyvnkadavqdsemvelveleirelltefgykgeetpiivgsalcaleqrdpelglk
svqklldavdtyipvp

SCOPe Domain Coordinates for d1d2ed3:

Click to download the PDB-style file with coordinates for d1d2ed3.
(The format of our PDB-style files is described here.)

Timeline for d1d2ed3: