SCOPe 2.04: Domain d4p3ab_: 4p3a B:

Lineage for d4p3ab_ (4p3a B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.50: Anaphylotoxins (complement system) [47685] (1 superfamily)
   4 helices; irregular array, disulfide-linked

4. Superfamily a.50.1: Anaphylotoxins (complement system) [47686] (1 family)

5. Family a.50.1.1: Anaphylotoxins (complement system) [47687] (3 proteins)
   can be classified as disulfide-rich
   Pfam PF01821

6. Protein automated matches [257397] (1 species)
   not a true protein

7. Species Mus musculus [TaxId:10090] [257398] (2 PDB entries)

8. Domain d4p3ab_: 4p3a B: [257400]
   automated match to d1kjsa_
   complexed with fmt

Details for d4p3ab_

PDB Entry: 4p3a, 1.4 Å

PDB Description: crystal structure of the mouse c5a anaphylatoxin

PDB Compounds: (B:) Complement C5

SCOPe Domain Sequences for d4p3ab_:

Sequence; same for both SEQRES and ATOM records:

>d4p3ab_ a.50.1.1 (B:) automated matches {Mus musculus [TaxId: 10090]}
ganlhllrqkieeqaakykhsvpkkccydgarvnfyetceervarvtigplcirafnecc
tiankirke

Timeline for d4p3ab_:

• d4p3ab_ is new in SCOPe 2.04-stable
  
• d4p3ab_ appears in SCOPe 2.05
  
• d4p3ab_ appears in the current release, SCOPe 2.08, called d4p3ab1