Lineage for d4p3aa1 (4p3a A:679-746)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2327856Fold a.50: Anaphylotoxins (complement system) [47685] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 2327857Superfamily a.50.1: Anaphylotoxins (complement system) [47686] (1 family) (S)
  5. 2327858Family a.50.1.1: Anaphylotoxins (complement system) [47687] (3 proteins)
    can be classified as disulfide-rich
    Pfam PF01821
  6. 2327876Protein automated matches [257397] (2 species)
    not a true protein
  7. 2327880Species Mouse (Mus musculus) [TaxId:10090] [257398] (2 PDB entries)
  8. 2327881Domain d4p3aa1: 4p3a A:679-746 [257399]
    Other proteins in same PDB: d4p3aa2, d4p3ab2, d4p3ac2, d4p3ad2
    automated match to d1kjsa_
    complexed with fmt

Details for d4p3aa1

PDB Entry: 4p3a (more details), 1.4 Å

PDB Description: crystal structure of the mouse c5a anaphylatoxin
PDB Compounds: (A:) Complement C5

SCOPe Domain Sequences for d4p3aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p3aa1 a.50.1.1 (A:679-746) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nlhllrqkieeqaakykhsvpkkccydgarvnfyetceervarvtigplcirafneccti
ankirkes

SCOPe Domain Coordinates for d4p3aa1:

Click to download the PDB-style file with coordinates for d4p3aa1.
(The format of our PDB-style files is described here.)

Timeline for d4p3aa1: