Class b: All beta proteins [48724] (126 folds) |
Fold b.44: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50464] (1 superfamily) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) probably related to the second domain and its superfamiy by a circular permutation |
Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (3 proteins) |
Protein Elongation factor Tu (EF-Tu) [50467] (4 species) |
Species Thermus aquaticus [TaxId:271] [50469] (4 PDB entries) |
Domain d1tttc2: 1ttt C:313-405 [25732] Other proteins in same PDB: d1ttta1, d1ttta3, d1tttb1, d1tttb3, d1tttc1, d1tttc3 protein/tRNA complex; complexed with 1ma, 2mg, 5mc, 5mu, 7mg, gnp, h2u, m2g, mg, omc, omg, psu, yg |
PDB Entry: 1ttt (more details), 2.7 Å
SCOP Domain Sequences for d1tttc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tttc2 b.44.1.1 (C:313-405) Elongation factor Tu (EF-Tu) {Thermus aquaticus} htkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgvemvmpgdnvtftv elikpvaleeglrfaireggrtvgagvvtkile
Timeline for d1tttc2: