Lineage for d1tttc2 (1ttt C:313-405)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 298577Fold b.44: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50464] (1 superfamily)
    barrel, closed; n=6, S=10; greek-key
  4. 298578Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 298579Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (3 proteins)
  6. 298589Protein Elongation factor Tu (EF-Tu) [50467] (4 species)
  7. 298604Species Thermus aquaticus [TaxId:271] [50469] (4 PDB entries)
  8. 298609Domain d1tttc2: 1ttt C:313-405 [25732]
    Other proteins in same PDB: d1ttta1, d1ttta3, d1tttb1, d1tttb3, d1tttc1, d1tttc3
    protein/tRNA complex; complexed with 1ma, 2mg, 5mc, 5mu, 7mg, gnp, h2u, m2g, mg, omc, omg, psu, yg

Details for d1tttc2

PDB Entry: 1ttt (more details), 2.7 Å

PDB Description: phe-trna, elongation factor ef-tu:gdpnp ternary complex

SCOP Domain Sequences for d1tttc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tttc2 b.44.1.1 (C:313-405) Elongation factor Tu (EF-Tu) {Thermus aquaticus}
htkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgvemvmpgdnvtftv
elikpvaleeglrfaireggrtvgagvvtkile

SCOP Domain Coordinates for d1tttc2:

Click to download the PDB-style file with coordinates for d1tttc2.
(The format of our PDB-style files is described here.)

Timeline for d1tttc2: