SCOP 1.65: Domain d1ttta2: 1ttt A:314-405

Lineage for d1ttta2 (1ttt A:314-405)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.44: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50464] (1 superfamily)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family)
   probably related to the second domain and its superfamiy by a circular permutation

5. Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (3 proteins)

6. Protein Elongation factor Tu (EF-Tu) [50467] (4 species)

7. Species Thermus aquaticus [TaxId:271] [50469] (4 PDB entries)

8. Domain d1ttta2: 1ttt A:314-405 [25730]
   Other proteins in same PDB: d1ttta1, d1ttta3, d1tttb1, d1tttb3, d1tttc1, d1tttc3

Details for d1ttta2

PDB Entry: 1ttt, 2.7 Å

PDB Description: phe-trna, elongation factor ef-tu:gdpnp ternary complex

SCOP Domain Sequences for d1ttta2:

Sequence; same for both SEQRES and ATOM records:

>d1ttta2 b.44.1.1 (A:314-405) Elongation factor Tu (EF-Tu) {Thermus aquaticus}
tkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgvemvmpgdnvtftve
likpvaleeglrfaireggrtvgagvvtkile

Timeline for d1ttta2:

• d1ttta2 first appeared (with stable ids) in SCOP 1.55
  
• d1ttta2 appears in SCOP 1.63
  
• d1ttta2 appears in SCOP 1.67
  
• d1ttta2 appears in the current release, SCOPe 2.08