Class b: All beta proteins [48724] (176 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.10: AlkB-like [141628] (3 proteins) automatically mapped to Pfam PF13532 |
Protein automated matches [191077] (1 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [189001] (22 PDB entries) |
Domain d4niha_: 4nih A: [257163] automated match to d3khca_ protein/DNA complex; protein/RNA complex; complexed with akg, gol, mn; mutant |
PDB Entry: 4nih (more details), 1.37 Å
SCOPe Domain Sequences for d4niha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4niha_ b.82.2.10 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} plaagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtthr qgylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklclhqd kdlpdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqplk agfhpltidcrynltfrqagk
Timeline for d4niha_: