Lineage for d4niha_ (4nih A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2404605Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2404877Family b.82.2.10: AlkB-like [141628] (3 protein domains)
    automatically mapped to Pfam PF13532
  6. 2404894Protein automated matches [191077] (2 species)
    not a true protein
  7. 2404917Species Escherichia coli [TaxId:562] [313153] (4 PDB entries)
  8. 2404918Domain d4niha_: 4nih A: [257163]
    automated match to d3khca_
    protein/DNA complex; protein/RNA complex; complexed with akg, gol, mn; mutant

Details for d4niha_

PDB Entry: 4nih (more details), 1.37 Å

PDB Description: Crystal structure of AlkB E136L mutant protein with cofactors bound to dsDNA containing m6A/A
PDB Compounds: (A:) Alpha-ketoglutarate-dependent dioxygenase AlkB

SCOPe Domain Sequences for d4niha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4niha_ b.82.2.10 (A:) automated matches {Escherichia coli [TaxId: 562]}
plaagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtthr
qgylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklclhqd
kdlpdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqplk
agfhpltidcrynltfrqagk

SCOPe Domain Coordinates for d4niha_:

Click to download the PDB-style file with coordinates for d4niha_.
(The format of our PDB-style files is described here.)

Timeline for d4niha_: