Lineage for d4m81a_ (4m81 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2831217Protein automated matches [190057] (28 species)
    not a true protein
  7. 2831425Species Yeast (Candida albicans) [TaxId:5476] [188406] (8 PDB entries)
  8. 2831431Domain d4m81a_: 4m81 A: [257074]
    automated match to d3n9ka_
    complexed with glf, gol, pnw

Details for d4m81a_

PDB Entry: 4m81 (more details), 1.86 Å

PDB Description: the structure of e292s glycosynthase variant of exo-1,3-beta-glucanase from candida albicans complexed with 1-fluoro-alpha-d-glucopyranoside (donor) and p-nitrophenyl beta-d-glucopyranoside (acceptor) at 1.86a resolution
PDB Compounds: (A:) exo-1,3-beta-glucanase

SCOPe Domain Sequences for d4m81a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m81a_ c.1.8.3 (A:) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
awdydnnvirgvnlggwfvlepymtpslfepfqngndqsgvpvdeyhwtqtlgkeaalri
lqkhwstwiteqdfkqisnlglnfvripigywafqlldndpyvqgqvqylekalgwarkn
nirvwidlhgapgsqngfdnsglrdsynfqngdntqvtlnvlntifkkyggneysdvvig
iellneplgpvlnmdklkqffldgynslrqtgsvtpviihdafqvfgywnnfltvaegqw
nvvvdhhhyqvfsggelsrnindhisvacnwgwdakkeshwnvagswsaaltdcakwlng
vnrgaryegaydnapyigscqplldisqwsdehktdtrryieaqldafeytggwvfwswk
tenapewsfqtltynglfpqpvtdrqfpnqcgfh

SCOPe Domain Coordinates for d4m81a_:

Click to download the PDB-style file with coordinates for d4m81a_.
(The format of our PDB-style files is described here.)

Timeline for d4m81a_: