SCOP 1.71: Domain d1dar_1: 1dar 283-400

Lineage for d1dar_1 (1dar 283-400)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (3 families)

5. Family b.43.3.1: Elongation factors [50448] (9 proteins)

6. Protein Elongation factor G (EF-G), domain II [50456] (1 species)

7. Species Thermus thermophilus [TaxId:274] [50457] (6 PDB entries)

8. Domain d1dar_1: 1dar 283-400 [25707]
   Other proteins in same PDB: d1dar_2, d1dar_3, d1dar_4
   complexed with gdp

Details for d1dar_1

PDB Entry: 1dar, 2.4 Å

PDB Description: elongation factor g in complex with gdp

SCOP Domain Sequences for d1dar_1:

Sequence; same for both SEQRES and ATOM records:

>d1dar_1 b.43.3.1 (283-400) Elongation factor G (EF-G), domain II {Thermus thermophilus}
pldippikgttpegevveihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvy
nttkgrkervarllrmhanhreeveelkagdlgavvglketitgdtlvgedaprvile

Timeline for d1dar_1:

• d1dar_1 first appeared (with stable ids) in SCOP 1.55
  
• d1dar_1 appears in SCOP 1.69
  
• d1dar_1 is called d1dara1 in SCOP 1.73
  
• d1dar_1 appears in the current release, SCOPe 2.08, called d1dara1