PDB entry 1dar

View 1dar on RCSB PDB site
Description: elongation factor g in complex with gdp
Deposited on 1996-02-15, released 1996-07-11
The last revision prior to the SCOP 1.71 freeze date was dated 1996-07-11, with a file datestamp of 1996-07-11.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.22
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1dar_ (-)
    mavkveydlkrlrnigiaahidagktttterilyytgrihkigevhegaatmdfmeqere
    rgititaavttcfwkdhriniidtpghvdftieversmrvldgaivvfdssqgvepqset
    vwrqaekykvpriafankmdktgadlwlvirtmqerlgarpvvmqlpigredtfsgiidv
    lrmkaytygndlgtdireipipeeyldqareyheklvevaadfdenimlkylegeeptee
    elvaairkgtidlkitpvflgsalknkgvqllldavvdylpspldippikgttpegevve
    ihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvynttkgrkervarllrmha
    nhreeveelkagdlgavvglketitgdtlvgedaprvilesievpepvidvaiepktkad
    qeklsqalarlaeedptfrvsthpetgqtiisgmgelhleiivdrlkrefkvdanvgkpq
    vayretitkpvdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvipkeyip
    avqkgieeamqsgpligfpvvdikvtlydgsyhevdssemafkiagsmaikeavqkgdpv
    ilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdlr
    sktqgrgsfvmffdhyqevpkqvqeklikgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dar_ (-)
    mavkveydlkrlrnigiaahidagktttterilyytgriaavttcfwkdhriniidtpgh
    vdftieversmrvldgaivvfdssqgvepqsetvwrqaekykvpriafankmdktgadlw
    lvirtmqerlgarpvvmqlpigredtfsgiidvlrmkaytygndlgtdireipipeeyld
    qareyheklvevaadfdenimlkylegeepteeelvaairkgtidlkitpvflgsalknk
    gvqllldavvdylpspldippikgttpegevveihpdpngplaalafkimadpyvgrltf
    irvysgtltsgsyvynttkgrkervarllrmhanhreeveelkagdlgavvglketitgd
    tlvgedaprvileseedptfrvsthqtiisgmgellkrefkvdanvgkpqvayretitkp
    vdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvipkeyipavqkgieeam
    qsgpligfpvvdikvtlydgsyhevdssemafkiagsmaikeavqkgdpvilepimrvev
    ttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdlrsktqgrgsfv
    mffdhyqevpkqvqeklik