Lineage for d1d2eb1 (1d2e B:251-348)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1126671Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1126691Superfamily b.43.3: Translation proteins [50447] (6 families) (S)
  5. 1126692Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. 1126772Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
    N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology
  7. 1126773Species Cow (Bos taurus), mitochondrial [TaxId:9913] [50453] (2 PDB entries)
    Uniprot P49410 56-452
  8. 1126775Domain d1d2eb1: 1d2e B:251-348 [25702]
    Other proteins in same PDB: d1d2ea2, d1d2ea3, d1d2eb2, d1d2eb3, d1d2ec2, d1d2ec3, d1d2ed2, d1d2ed3
    protein/RNA complex; complexed with gdp, mg

Details for d1d2eb1

PDB Entry: 1d2e (more details), 1.94 Å

PDB Description: crystal structure of mitochondrial ef-tu in complex with gdp
PDB Compounds: (B:) elongation factor tu (ef-tu)

SCOPe Domain Sequences for d1d2eb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d2eb1 b.43.3.1 (B:251-348) Elongation factor Tu (EF-Tu), domain 2 {Cow (Bos taurus), mitochondrial [TaxId: 9913]}
trdlekpfllpvesvysipgrgtvvtgtlergilkkgdeceflghsknirtvvtgiemfh
ksldraeagdnlgalvrglkredlrrglvmakpgsiqp

SCOPe Domain Coordinates for d1d2eb1:

Click to download the PDB-style file with coordinates for d1d2eb1.
(The format of our PDB-style files is described here.)

Timeline for d1d2eb1: