Lineage for d4l1xa_ (4l1x A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1568069Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 1568070Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 1568090Protein 3-alpha-hydroxysteroid dehydrogenase [51439] (2 species)
  7. 1568091Species Human (Homo sapiens), type III [TaxId:9606] [69383] (14 PDB entries)
    bile acid binding protein
  8. 1568114Domain d4l1xa_: 4l1x A: [256965]
    automated match to d1xjba_
    complexed with nap, so4, str; mutant

Details for d4l1xa_

PDB Entry: 4l1x (more details), 2 Å

PDB Description: Crystal Structuer of Human 3-alpha Hydroxysteroid Dehydrogenase Type 3 V54L Mutant in Complex with NADP+ and Progesterone
PDB Compounds: (A:) Aldo-keto reductase family 1 member C2

SCOPe Domain Sequences for d4l1xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l1xa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Human (Homo sapiens), type III [TaxId: 9606]}
svddskyqcvklndghfmpvlgfgtyapaevpkskaleavklaieagfhhidsahlynne
eqvglairskiadgsvkredifytsklwsnshrpelvrpalerslknlqldyvdlylihf
pvsvkpgeevipkdengkilfdtvdlcatweamekckdaglaksigvsnfnhrllemiln
kpglkykpvcnqvechpyfnqrklldfckskdivlvaysalgshreepwvdpnspvlled
pvlcalakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltseemkaidg
lnrnvryltldifagppnypfsdey

SCOPe Domain Coordinates for d4l1xa_:

Click to download the PDB-style file with coordinates for d4l1xa_.
(The format of our PDB-style files is described here.)

Timeline for d4l1xa_: