Lineage for d4kx4a1 (4kx4 A:-2-75)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1854430Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1854431Protein automated matches [190056] (147 species)
    not a true protein
  7. 1854834Species Escherichia coli [TaxId:83333] [256896] (2 PDB entries)
  8. 1854835Domain d4kx4a1: 4kx4 A:-2-75 [256917]
    Other proteins in same PDB: d4kx4a2
    automated match to d3ir4a1
    complexed with acy, gsh

Details for d4kx4a1

PDB Entry: 4kx4 (more details), 1.6 Å

PDB Description: Crystal structure of Escherichia coli glutaredoxin 2 complex with glutathione
PDB Compounds: (A:) Glutaredoxin-2

SCOPe Domain Sequences for d4kx4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kx4a1 c.47.1.0 (A:-2-75) automated matches {Escherichia coli [TaxId: 83333]}
samklyiydhcpyclkarmifglknipvelhvllnddaetptrmvgqkqvpilqkddsry
mpesmdivhyvdkldgk

SCOPe Domain Coordinates for d4kx4a1:

Click to download the PDB-style file with coordinates for d4kx4a1.
(The format of our PDB-style files is described here.)

Timeline for d4kx4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4kx4a2