| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (147 species) not a true protein |
| Species Escherichia coli [TaxId:83333] [256896] (2 PDB entries) |
| Domain d4kx4a1: 4kx4 A:-2-75 [256917] Other proteins in same PDB: d4kx4a2 automated match to d3ir4a1 complexed with acy, gsh |
PDB Entry: 4kx4 (more details), 1.6 Å
SCOPe Domain Sequences for d4kx4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kx4a1 c.47.1.0 (A:-2-75) automated matches {Escherichia coli [TaxId: 83333]}
samklyiydhcpyclkarmifglknipvelhvllnddaetptrmvgqkqvpilqkddsry
mpesmdivhyvdkldgk
Timeline for d4kx4a1: