SCOPe 2.06: Domain d4kx4a1: 4kx4 A:1-75

Lineage for d4kx4a1 (4kx4 A:1-75)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (165 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [256896] (3 PDB entries)

8. Domain d4kx4a1: 4kx4 A:1-75 [256917]
   Other proteins in same PDB: d4kx4a2, d4kx4a3
   automated match to d3ir4a1
   complexed with acy, gsh

Details for d4kx4a1

PDB Entry: 4kx4, 1.6 Å

PDB Description: Crystal structure of Escherichia coli glutaredoxin 2 complex with glutathione

PDB Compounds: (A:) Glutaredoxin-2

SCOPe Domain Sequences for d4kx4a1:

Sequence; same for both SEQRES and ATOM records:

>d4kx4a1 c.47.1.0 (A:1-75) automated matches {Escherichia coli [TaxId: 83333]}
mklyiydhcpyclkarmifglknipvelhvllnddaetptrmvgqkqvpilqkddsrymp
esmdivhyvdkldgk

Timeline for d4kx4a1:

• d4kx4a1 first appeared in SCOPe 2.04
  
• d4kx4a1 appears in SCOPe 2.05
  
• d4kx4a1 appears in SCOPe 2.07
  
• d4kx4a1 appears in the current release, SCOPe 2.08