Lineage for d1ttta1 (1ttt A:213-313)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 801216Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 801236Superfamily b.43.3: Translation proteins [50447] (6 families) (S)
  5. 801237Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. 801311Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
    N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology
  7. 801331Species Thermus aquaticus [TaxId:271] [50451] (4 PDB entries)
  8. 801334Domain d1ttta1: 1ttt A:213-313 [25690]
    Other proteins in same PDB: d1ttta2, d1ttta3, d1tttb2, d1tttb3, d1tttc2, d1tttc3

Details for d1ttta1

PDB Entry: 1ttt (more details), 2.7 Å

PDB Description: phe-trna, elongation factor ef-tu:gdpnp ternary complex
PDB Compounds: (A:) of elongation factor tu (ef-tu)

SCOP Domain Sequences for d1ttta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ttta1 b.43.3.1 (A:213-313) Elongation factor Tu (EF-Tu), domain 2 {Thermus aquaticus [TaxId: 271]}
pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktvvtgvem
hrktlqegiagdnvglllrgvsreevergqvlakpgsitph

SCOP Domain Coordinates for d1ttta1:

Click to download the PDB-style file with coordinates for d1ttta1.
(The format of our PDB-style files is described here.)

Timeline for d1ttta1: