Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (78 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species) |
Species Thermus aquaticus [TaxId:271] [52628] (4 PDB entries) |
Domain d1ttta3: 1ttt A:1-212 [32125] Other proteins in same PDB: d1ttta1, d1ttta2, d1tttb1, d1tttb2, d1tttc1, d1tttc2 |
PDB Entry: 1ttt (more details), 2.7 Å
SCOP Domain Sequences for d1ttta3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ttta3 c.37.1.8 (A:1-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus aquaticus [TaxId: 271]} akgefirtkphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerarg itintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehi llarqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallale emhknpktkrgenewvdkiwelldaideyipt
Timeline for d1ttta3: