Lineage for d4kkza2 (4kkz A:121-431)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1938246Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 1938247Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 1938248Family d.159.1.1: Purple acid phosphatase-like [56301] (3 proteins)
  6. 1938272Protein automated matches [190524] (2 species)
    not a true protein
  7. 1938273Species French bean (Phaseolus vulgaris) [TaxId:3885] [226472] (6 PDB entries)
  8. 1938284Domain d4kkza2: 4kkz A:121-431 [256867]
    Other proteins in same PDB: d4kkza1, d4kkzb1, d4kkzc1, d4kkzd1
    automated match to d1kbpa2
    complexed with 1rf, act, edo, fe, gol, na, nag, pge, so4, zn

Details for d4kkza2

PDB Entry: 4kkz (more details), 2.2 Å

PDB Description: the crystal structure of red kidney bean purple acid phosphatase in complex with diethylene glycol monovanadate
PDB Compounds: (A:) purple acid phosphatase

SCOPe Domain Sequences for d4kkza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kkza2 d.159.1.1 (A:121-431) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]}
qtgldvpytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwd
twgrftersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysi
krasahiivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmeg
eamrtkfeawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitig
dagnygvidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwf
fnrhwypvdds

SCOPe Domain Coordinates for d4kkza2:

Click to download the PDB-style file with coordinates for d4kkza2.
(The format of our PDB-style files is described here.)

Timeline for d4kkza2: