PDB entry 4kkz

View 4kkz on RCSB PDB site
Description: The crystal structure of red kidney bean purple acid phosphatase in complex with diethylene glycol monovanadate
Class: Hydrolase
Keywords: beta barrel, Phosphatase, Hydrolase, Vanadate, Cotyledon cells
Deposited on 2013-05-06, released 2014-05-21
Made obsolete by 6hwr on 2019-04-03

The last revision prior to the SCOPe 2.05 freeze date was dated 2014-05-21, with a file datestamp of 2014-05-16.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.153
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purple acid phosphatase
    Species: Phaseolus vulgaris [TaxId:3885]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4kkza1, d4kkza2
  • Chain 'B':
    Compound: purple acid phosphatase
    Species: Phaseolus vulgaris [TaxId:3885]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4kkzb1, d4kkzb2
  • Chain 'C':
    Compound: purple acid phosphatase
    Species: Phaseolus vulgaris [TaxId:3885]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4kkzc1, d4kkzc2
  • Chain 'D':
    Compound: purple acid phosphatase
    Species: Phaseolus vulgaris [TaxId:3885]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4kkzd1, d4kkzd2
  • Heterogens: ZN, FE, NAG, SO4, EDO, GOL, ACT, NA, 1RF, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kkzA (A:)
    knrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngr
    kriakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldv
    pytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrft
    ersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasah
    iivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtk
    feawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitigdagnyg
    vidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwy
    pvddst
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kkzA (A:)
    nrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrk
    riakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldvp
    ytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrfte
    rsvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasahi
    ivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtkf
    eawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitigdagnygv
    idsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwyp
    vdds
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4kkzB (B:)
    knrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngr
    kriakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldv
    pytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrft
    ersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasah
    iivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtk
    feawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitigdagnyg
    vidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwy
    pvddst
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kkzB (B:)
    nrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrk
    riakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldvp
    ytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrfte
    rsvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasahi
    ivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtkf
    eawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitigdagnygv
    idsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwyp
    vddst
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4kkzC (C:)
    knrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngr
    kriakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldv
    pytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrft
    ersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasah
    iivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtk
    feawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitigdagnyg
    vidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwy
    pvddst
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kkzC (C:)
    nrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrk
    riakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldvp
    ytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrfte
    rsvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasahi
    ivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtkf
    eawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitigdagnygv
    idsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwyp
    vdd
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4kkzD (D:)
    knrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngr
    kriakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldv
    pytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrft
    ersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasah
    iivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtk
    feawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitigdagnyg
    vidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwy
    pvddst