SCOPe 2.04: Domain d4jzkb2: 4jzk B:122-156

Lineage for d4jzkb2 (4jzk B:122-156)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (2 families)
   automatically mapped to Pfam PF05191

5. Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein)

6. Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (9 species)

7. Species Escherichia coli [TaxId:1133853] [256828] (1 PDB entry)

8. Domain d4jzkb2: 4jzk B:122-156 [256831]
   Other proteins in same PDB: d4jzka1, d4jzkb1
   automated match to d1akea2
   complexed with adp, amp

Details for d4jzkb2

PDB Entry: 4jzk, 1.63 Å

PDB Description: Crystal Structure of Adenylate kinase of E. Coli with ADP/AMP bound

PDB Compounds: (B:) adenylate kinase

SCOPe Domain Sequences for d4jzkb2:

Sequence; same for both SEQRES and ATOM records:

>d4jzkb2 g.41.2.1 (B:122-156) Microbial and mitochondrial ADK, insert "zinc finger" domain {Escherichia coli [TaxId: 1133853]}
grrvhapsgrvyhvkfnppkvegkddvtgeelttr

Timeline for d4jzkb2:

• d4jzkb2 is new in SCOPe 2.04-stable
  
• d4jzkb2 appears in SCOPe 2.05
  
• d4jzkb2 appears in the current release, SCOPe 2.08