| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies) 3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.44.2: PTS system IIB component-like [52794] (3 families) ![]() |
| Family c.44.2.0: automated matches [254256] (1 protein) not a true family |
| Protein automated matches [254590] (3 species) not a true protein |
| Species Escherichia coli [TaxId:83333] [256814] (1 PDB entry) |
| Domain d4jxda_: 4jxd A: [256815] automated match to d2kyra_ complexed with ni |
PDB Entry: 4jxd (more details), 2.4 Å
SCOPe Domain Sequences for d4jxda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jxda_ c.44.2.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
maylvavtacvsgvahtymaaerleklcllekwgvsietqgalgtenrladedirradva
llitdielagaerfehcryvqcsiyaflrepqrvmsavrkvlsapqqthlile
Timeline for d4jxda_: