Lineage for d4d2ob_ (4d2o B:)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1690252Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1690253Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1690254Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1690900Protein automated matches [190161] (19 species)
    not a true protein
  7. 1690919Species Citrobacter freundii [TaxId:546] [235913] (2 PDB entries)
  8. 1690922Domain d4d2ob_: 4d2o B: [256772]
    automated match to d3znwa_

Details for d4d2ob_

PDB Entry: 4d2o (more details), 2.2 Å

PDB Description: Crystal structure of the class A extended-spectrum beta-lactamase PER- 2
PDB Compounds: (B:) per-2 beta-lactamase

SCOPe Domain Sequences for d4d2ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d2ob_ e.3.1.1 (B:) automated matches {Citrobacter freundii [TaxId: 546]}
spllkeqietivtgkkatvgvavwgpddleplllnpfekfpmqsvfklhlamlvlhqvdq
gkldlnqsvtvnraavlqntwspmmkdhqgdeftvavqqllqysvshsdnvacdllfelv
ggpqalhayiqslgvkeaavvaneaqmhaddqvqyqnwtsmkaaaqvlqkfeqkkqlset
sqallwkwmvetttgpqrlkgllpagtivahktgtsgvragktaatndagvimlpdgrpl
lvavfvkdsaesertneaiiaqvaqaayqfelkklsav

SCOPe Domain Coordinates for d4d2ob_:

Click to download the PDB-style file with coordinates for d4d2ob_.
(The format of our PDB-style files is described here.)

Timeline for d4d2ob_: