SCOPe 2.07: Domain d4d0ld_: 4d0l D:

Lineage for d4d0ld_ (4d0l D:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (156 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (202 PDB entries)

8. Domain d4d0ld_: 4d0l D: [256765]
   automated match to d2bcgy_
   complexed with 093, gsp, mg

Details for d4d0ld_

PDB Entry: 4d0l, 2.94 Å

PDB Description: phosphatidylinositol 4-kinase iii beta-pik93 in a complex with rab11a- gtp gammas

PDB Compounds: (D:) Ras-related protein Rab-11A

SCOPe Domain Sequences for d4d0ld_:

Sequence; same for both SEQRES and ATOM records:

>d4d0ld_ c.37.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
deydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiw
dtagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnk
sdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivsqkqms

Timeline for d4d0ld_:

• d4d0ld_ first appeared in SCOPe 2.04
  
• d4d0ld_ appears in SCOPe 2.06
  
• d4d0ld_ appears in the current release, SCOPe 2.08