SCOPe 2.04: Domain d4czea2: 4cze A:150-333

Lineage for d4czea2 (4cze A:150-333)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (42 species)
   not a true protein

7. Species Caulobacter vibrioides [TaxId:155892] [256751] (4 PDB entries)

8. Domain d4czea2: 4cze A:150-333 [256753]
   automated match to d1jcfa2
   complexed with po4

Details for d4czea2

PDB Entry: 4cze, 2 Å

PDB Description: C. crescentus MreB, double filament, empty

PDB Compounds: (A:) rod shape-determining protein mreb

SCOPe Domain Sequences for d4czea2:

Sequence, based on SEQRES records:

>d4czea2 c.55.1.0 (A:150-333) automated matches {Caulobacter vibrioides [TaxId: 155892]}
lpiheptgsmvvdigggttevavlslsgivysrsvrvggdkmdeaiisymrrhhnllige
ttaerikkeigtarapadgeglsidvkgrdlmqgvprevrisekqaadalaepvgqivea
vkvaleatppelasdiadkgimltgggallrgldaeirdhtglpvtvaddplscvalgcg
kvle

Sequence, based on observed residues (ATOM records):

>d4czea2 c.55.1.0 (A:150-333) automated matches {Caulobacter vibrioides [TaxId: 155892]}
lpiheptgsmvvdigggttevavlslsgivysrsvrvggdkmdeaiisymrrhhnllige
ttaerikkeigtarapeglsidvkgrdlmqgvprevrisekqaadalaepvgqiveavkv
aleatppelasdiadkgimltgggallrgldaeirdhtglpvtvaddplscvalgcgkvl
e

Timeline for d4czea2:

• d4czea2 is new in SCOPe 2.04-stable
  
• d4czea2 appears in SCOPe 2.05
  
• d4czea2 appears in the current release, SCOPe 2.08