Lineage for d4cuda1 (4cud A:412-452)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1700389Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1701322Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 1701902Family g.3.11.0: automated matches [227227] (1 protein)
    not a true family
  6. 1701903Protein automated matches [226968] (2 species)
    not a true protein
  7. 1701904Species Human (Homo sapiens) [TaxId:9606] [225423] (21 PDB entries)
  8. 1701910Domain d4cuda1: 4cud A:412-452 [256714]
    automated match to d1toza1
    complexed with ca, fuc; mutant

Details for d4cuda1

PDB Entry: 4cud (more details), 1.85 Å

PDB Description: human notch1 egf domains 11-13 mutant fucosylated at t466
PDB Compounds: (A:) Neurogenic locus notch homolog protein 1

SCOPe Domain Sequences for d4cuda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cuda1 g.3.11.0 (A:412-452) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvdecslganpcehagkcintlgsfecqclqgytgprceid

SCOPe Domain Coordinates for d4cuda1:

Click to download the PDB-style file with coordinates for d4cuda1.
(The format of our PDB-style files is described here.)

Timeline for d4cuda1: