| Class b: All beta proteins [48724] (177 folds) |
| Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) ![]() |
| Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins) coupled with a NADP-binding domain of alpha/beta class |
| Protein Dihydroorotate dehydrogenase B, PyrK subunit [50433] (1 species) |
| Species Lactococcus lactis, isozyme B [TaxId:1358] [50434] (3 PDB entries) |
| Domain d1ep2b1: 1ep2 B:2-102 [25666] Other proteins in same PDB: d1ep2a_, d1ep2b2 complexed with fad, fes, fmn, oro |
PDB Entry: 1ep2 (more details), 2.4 Å
SCOPe Domain Sequences for d1ep2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ep2b1 b.43.4.2 (B:2-102) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]}
sqlqemmtvvsqrevaynifemvlkgtlvdemdlpgqflhlavpngamllrrpisisswd
kraktctilyrigdettgtyklsklesgakvdvmgplgngf
Timeline for d1ep2b1: