SCOPe 2.07: Domain d2piaa1: 2pia A:1-103

Lineage for d2piaa1 (2pia A:1-103)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
   coupled with a NADP-binding domain of alpha/beta class

6. Protein Phthalate dioxygenase reductase [50430] (1 species)
   contains additional 2Fe-2S ferredoxin domain

7. Species Pseudomonas cepacia, db01 [TaxId:292] [50431] (1 PDB entry)

8. Domain d2piaa1: 2pia A:1-103 [25663]
   Other proteins in same PDB: d2piaa2, d2piaa3
   complexed with fes, fmn

Details for d2piaa1

PDB Entry: 2pia, 2 Å

PDB Description: phthalate dioxygenase reductase: a modular structure for electron transfer from pyridine nucleotides to [2fe-2s]

PDB Compounds: (A:) phthalate dioxygenase reductase

SCOPe Domain Sequences for d2piaa1:

Sequence; same for both SEQRES and ATOM records:

>d2piaa1 b.43.4.2 (A:1-103) Phthalate dioxygenase reductase {Pseudomonas cepacia, db01 [TaxId: 292]}
ttpqedgflrlkiaskekiardiwsfeltdpqgaplppfeaganltvavpngsrrtyslc
ndsqernryviavkrdsngrggsisfiddtsegdavevslprn

Timeline for d2piaa1:

• d2piaa1 first appeared (with stable ids) in SCOP 1.55, called d2pia_1
  
• d2piaa1 appears in SCOPe 2.06
  
• d2piaa1 appears in the current release, SCOPe 2.08