SCOPe 2.07: Domain d4cfra_: 4cfr A:

Lineage for d4cfra_ (4cfr A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (2 proteins)
   dimer: subunits are made of two EF-hands

6. Protein automated matches [190132] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187203] (41 PDB entries)

8. Domain d4cfra_: 4cfr A: [256605]
   automated match to d1m31a_
   complexed with ca; mutant

Details for d4cfra_

PDB Entry: 4cfr, 1.4 Å

PDB Description: ca-bound s100a4 c3s, c81s, c86s and f45w mutant complexed with non- muscle myosin iia

PDB Compounds: (A:) Protein S100-A4

SCOPe Domain Sequences for d4cfra_:

Sequence; same for both SEQRES and ATOM records:

>d4cfra_ a.39.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
asplekaldvmvstfhkysgkegdkfklnkselkelltrelpswlgkrtdeaafqklmsn
ldsnrdnevdfqeycvflssiammsneffegfpd

Timeline for d4cfra_:

• d4cfra_ first appeared in SCOPe 2.04
  
• d4cfra_ appears in SCOPe 2.06
  
• d4cfra_ appears in the current release, SCOPe 2.08