Lineage for d4cbxa2 (4cbx A:147-373)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1606124Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1606125Protein automated matches [226839] (42 species)
    not a true protein
  7. 1606414Species Plasmodium berghei [TaxId:5821] [256595] (1 PDB entry)
  8. 1606416Domain d4cbxa2: 4cbx A:147-373 [256597]
    automated match to d1c0fa2
    complexed with atp, ca, na, po4, so4

Details for d4cbxa2

PDB Entry: 4cbx (more details), 2.2 Å

PDB Description: crystal structure of plasmodium berghei actin ii
PDB Compounds: (A:) actin-2

SCOPe Domain Sequences for d4cbxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cbxa2 c.55.1.0 (A:147-373) automated matches {Plasmodium berghei [TaxId: 5821]}
rttgivldsgdgvthtvpiyegyvlphainrtdmagrdltyymmklftergytftttaer
eivrdikeklcyialdydeelkkseerteeveemyelpdgnlitvgserfrcpealfnps
ligrecpglhitayqsimkcdidirkelynnivlsggttmynyigerltnemtslappsm
kikviapperkysvwiggsilsslstfqkmwitkeeydesgpsivhr

SCOPe Domain Coordinates for d4cbxa2:

Click to download the PDB-style file with coordinates for d4cbxa2.
(The format of our PDB-style files is described here.)

Timeline for d4cbxa2: