![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) ![]() |
![]() | Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (8 proteins) coupled with a NADP-binding domain of alpha/beta class |
![]() | Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species) |
![]() | Species Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId:1167] [50420] (15 PDB entries) |
![]() | Domain d1bjk_1: 1bjk 9-141 [25649] Other proteins in same PDB: d1bjk_2 complexed with fad, so4; mutant |
PDB Entry: 1bjk (more details), 2.3 Å
SCOP Domain Sequences for d1bjk_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bjk_1 b.43.4.2 (9-141) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Cyanobacterium (Anabaena sp.), pcc 7119} dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgvd kngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepgs evkitgpvgkeml
Timeline for d1bjk_1: