Class b: All beta proteins [48724] (180 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) |
Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins) coupled with a NADP-binding domain of alpha/beta class |
Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (9 species) |
Domain d1bjka1: 1bjk A:9-141 [25649] Other proteins in same PDB: d1bjka2 complexed with fad, so4; mutant |
PDB Entry: 1bjk (more details), 2.3 Å
SCOPe Domain Sequences for d1bjka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bjka1 b.43.4.2 (A:9-141) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Anabaena sp., pcc 7119 [TaxId: 1167]} dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgvd kngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepgs evkitgpvgkeml
Timeline for d1bjka1: